PDB entry 1u61

View 1u61 on RCSB PDB site
Description: Crystal Structure of Putative Ribonuclease III from Bacillus cereus
Class: structural genomics, unknown function
Keywords: structural genomics, hypothetical protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2004-07-29, released 2004-09-21
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.207
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Bacillus cereus
    Gene: BC0111
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81J58
      • modified residue (17)
    Domains in SCOP 1.73: d1u61a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1u61A (A:)
snamidakqlnslalaymgdavyeqyiryhllqkgkvrpnqlhrlgtsfvsakaqakvvy
hlletaflteeeeavlrrgrnansgtvpkntdvqtyrhstafealigyhhllnnrerlde
ivykaiavleeqeggtss

    Sequence, based on observed residues (ATOM records): (download) 
    >1u61A (A:)
idakqlnslalaymgdavyeqyiryhllqkgkvrpnqlhrlgtsfvsakaqakvvyhlle
taflteeeeavlrrgrnansgtvpkntdvqtyrhstafealigyhhllnnrerldeivyk
aiavlee