PDB entry 1u60

View 1u60 on RCSB PDB site
Description: MCSG APC5046 Probable glutaminase ybaS
Class: hydrolase
Keywords: structural genomics, APC5046, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2004-07-28, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.145
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable glutaminase ybaS
    Species: Escherichia coli [TaxId:562]
    Gene: ybaS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u60a_
  • Chain 'B':
    Compound: Probable glutaminase ybaS
    Species: Escherichia coli [TaxId:562]
    Gene: ybaS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u60b_
  • Chain 'C':
    Compound: Probable glutaminase ybaS
    Species: Escherichia coli [TaxId:562]
    Gene: ybaS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u60c_
  • Chain 'D':
    Compound: Probable glutaminase ybaS
    Species: Escherichia coli [TaxId:562]
    Gene: ybaS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u60d_
  • Heterogens: EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u60A (A:)
    mldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdy
    rfalesiskvctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnaga
    iattslinaenveqrwqrilhiqqqlageqvalsdevnqseqttnfhnraiawllysagy
    lycdameacdvytrqcstllntielatlgatlaaggvnplthkrvlqadnvpyilaemmm
    eglygrsgdwayrvglpgksgvgggilavvpgvmgiaafsppldedgnsvrgqkmvasva
    kqlgynvfkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u60A (A:)
    ldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdyr
    falesiskvctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnagai
    attslinaenveqrwqrilhiqqqlageqvalsdevnqseqttnfhnraiawllysagyl
    ycdameacdvytrqcstllntielatlgatlaaggvnplthkrvlqadnvpyilaemmme
    glygrsgdwayrvglpgksgvgggilavvpgvmgiaafsppldedgnsvrgqkmvasvak
    qlgynvfkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u60B (B:)
    mldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdy
    rfalesiskvctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnaga
    iattslinaenveqrwqrilhiqqqlageqvalsdevnqseqttnfhnraiawllysagy
    lycdameacdvytrqcstllntielatlgatlaaggvnplthkrvlqadnvpyilaemmm
    eglygrsgdwayrvglpgksgvgggilavvpgvmgiaafsppldedgnsvrgqkmvasva
    kqlgynvfkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u60B (B:)
    ldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdyr
    falesiskvctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnagai
    attslinaenveqrwqrilhiqqqlageqvalsdevnqseqttnfhnraiawllysagyl
    ycdameacdvytrqcstllntielatlgatlaaggvnplthkrvlqadnvpyilaemmme
    glygrsgdwayrvglpgksgvgggilavvpgvmgiaafsppldedgnsvrgqkmvasvak
    qlgynvfkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u60C (C:)
    mldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdy
    rfalesiskvctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnaga
    iattslinaenveqrwqrilhiqqqlageqvalsdevnqseqttnfhnraiawllysagy
    lycdameacdvytrqcstllntielatlgatlaaggvnplthkrvlqadnvpyilaemmm
    eglygrsgdwayrvglpgksgvgggilavvpgvmgiaafsppldedgnsvrgqkmvasva
    kqlgynvfkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u60C (C:)
    ldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdyr
    falesiskvctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnagai
    attslinaenveqrwqrilhiqqqlageqvalsdevnqseqttnfhnraiawllysagyl
    ycdameacdvytrqcstllntielatlgatlaaggvnplthkrvlqadnvpyilaemmme
    glygrsgdwayrvglpgksgvgggilavvpgvmgiaafsppldedgnsvrgqkmvasvak
    qlgynvfkg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u60D (D:)
    mldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdy
    rfalesiskvctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnaga
    iattslinaenveqrwqrilhiqqqlageqvalsdevnqseqttnfhnraiawllysagy
    lycdameacdvytrqcstllntielatlgatlaaggvnplthkrvlqadnvpyilaemmm
    eglygrsgdwayrvglpgksgvgggilavvpgvmgiaafsppldedgnsvrgqkmvasva
    kqlgynvfkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u60D (D:)
    ldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdyr
    falesiskvctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnagai
    attslinaenveqrwqrilhiqqqlageqvalsdevnqseqttnfhnraiawllysagyl
    ycdameacdvytrqcstllntielatlgatlaaggvnplthkrvlqadnvpyilaemmme
    glygrsgdwayrvglpgksgvgggilavvpgvmgiaafsppldedgnsvrgqkmvasvak
    qlgynvfkg