PDB entry 1u5y

View 1u5y on RCSB PDB site
Description: crystal structure of murine april, ph 8.0
Deposited on 2004-07-28, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u5ya_
  • Chain 'B':
    Domains in SCOP 1.71: d1u5yb_
  • Chain 'D':
    Domains in SCOP 1.71: d1u5yd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5yA (A:)
    gskkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvl
    fhdvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkip
    ranaklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5yA (A:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5yB (B:)
    gskkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvl
    fhdvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkip
    ranaklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5yB (B:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u5yD (D:)
    gskkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvl
    fhdvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkip
    ranaklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5yD (D:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsaynscysagvfhlhqgdiitvkipranaklslsp
    hgtflgfvkl