PDB entry 1u5x

View 1u5x on RCSB PDB site
Description: Crystal structure of murine APRIL at pH 5.0
Class: cytokine, hormone/growth factor
Keywords: TNFSF, cytokine, jelly-roll, trimer, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2004-07-28, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 13
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf13, APRIL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u5xa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5xA (A:)
    gskkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvl
    fhdvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkip
    ranaklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5xA (A:)
    khsvlhlvpvnitsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhdvtft
    mgqvvsregqgrretlfrcirsmpsdaynscysagvfhlhqgdiitvkipranaklslsp
    hgtflgfvkl