PDB entry 1u5w

View 1u5w on RCSB PDB site
Description: Crystal structure of hypothetical protein yjjX from Escherichia coli
Class: unknown function
Keywords: 3 layers Alpha/Beta/Alpha protein, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-07-28, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0244 protein yjjX
    Species: Escherichia coli [TaxId:562]
    Gene: yjjX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39411 (3-172)
      • cloning artifact (173)
    Domains in SCOPe 2.07: d1u5wa1, d1u5wa2
  • Chain 'B':
    Compound: Hypothetical UPF0244 protein yjjX
    Species: Escherichia coli [TaxId:562]
    Gene: yjjX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39411 (3-172)
      • cloning artifact (2)
      • cloning artifact (173)
    Domains in SCOPe 2.07: d1u5wb2, d1u5wb3, d1u5wb4
  • Chain 'C':
    Compound: Hypothetical UPF0244 protein yjjX
    Species: Escherichia coli [TaxId:562]
    Gene: yjjX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39411 (3-172)
      • cloning artifact (1-2)
      • cloning artifact (173-174)
    Domains in SCOPe 2.07: d1u5wc2, d1u5wc3, d1u5wc4
  • Chain 'D':
    Compound: Hypothetical UPF0244 protein yjjX
    Species: Escherichia coli [TaxId:562]
    Gene: yjjX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39411 (3-172)
      • cloning artifact (2)
      • cloning artifact (173)
    Domains in SCOPe 2.07: d1u5wd2, d1u5wd3, d1u5wd4
  • Chain 'E':
    Compound: Hypothetical UPF0244 protein yjjX
    Species: Escherichia coli [TaxId:562]
    Gene: yjjX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39411 (3-172)
      • cloning artifact (2)
      • cloning artifact (173)
    Domains in SCOPe 2.07: d1u5we2, d1u5we3, d1u5we4
  • Chain 'F':
    Compound: Hypothetical UPF0244 protein yjjX
    Species: Escherichia coli [TaxId:562]
    Gene: yjjX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39411 (3-172)
      • cloning artifact (173-174)
    Domains in SCOPe 2.07: d1u5wf2, d1u5wf3
  • Chain 'G':
    Compound: Hypothetical UPF0244 protein yjjX
    Species: Escherichia coli [TaxId:562]
    Gene: yjjX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39411 (3-172)
      • cloning artifact (1-2)
      • cloning artifact (173)
    Domains in SCOPe 2.07: d1u5wg2, d1u5wg3, d1u5wg4
  • Chain 'H':
    Compound: Hypothetical UPF0244 protein yjjX
    Species: Escherichia coli [TaxId:562]
    Gene: yjjX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u5wh_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5wA (A:)
    mlimhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarn
    rvanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvreg
    ealgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysgrvehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5wA (A:)
    mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrva
    narrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregeal
    gpvmsryegaigvftagkltrasvyhqavilalspfhnavys
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5wB (B:)
    mlimhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarn
    rvanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvreg
    ealgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysgrvehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5wB (B:)
    imhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrv
    anarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregea
    lgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavys
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u5wC (C:)
    mlimhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarn
    rvanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvreg
    ealgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysgrvehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5wC (C:)
    limhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnr
    vanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvrege
    algpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u5wD (D:)
    mlimhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarn
    rvanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvreg
    ealgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysgrvehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5wD (D:)
    imhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrv
    anarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregea
    lgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavys
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u5wE (E:)
    mlimhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarn
    rvanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvreg
    ealgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysgrvehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5wE (E:)
    imhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrv
    anarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregea
    lgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavys
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u5wF (F:)
    mlimhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarn
    rvanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvreg
    ealgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysgrvehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5wF (F:)
    mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrva
    narrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregeal
    gpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1u5wG (G:)
    mlimhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarn
    rvanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvreg
    ealgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysgrvehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5wG (G:)
    limhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnr
    vanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvrege
    algpvmsrytgikegaigvftagkltrasvyhqavilalspfhnavys
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1u5wH (H:)
    mlimhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarn
    rvanarrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvreg
    ealgpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavysgrvehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5wH (H:)
    mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrva
    narrllpeadfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregeal
    gpvmsrytgideigrkegaigvftagkltrasvyhqavilalspfhnavy