PDB entry 1u5t

View 1u5t on RCSB PDB site
Description: Structure of the ESCRT-II endosomal trafficking complex
Deposited on 2004-07-28, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.226
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5tA (A:)
    mkqfglaafdelkdgkyndvnktilekqsvelrdqlmvfqerlvefakkhnselqaspef
    rskfmhmcssigidplslfdrdkhlftvndfyyevclkvieicrqtkdmnggvisfqele
    kvhfrklnvglddleksidmlkslecfeifqirgkkflrsvpneltsdqtkileicsilg
    yssisllkanlgweavrsksaldemvangllwidyqggaealywdpswitrql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5tA (A:)
    vnktilekqsvelrdqlmvfqerlvefakkhnselqaspefrskfmhmcssigidplslf
    drdkhlftvndfyyevclkvieicrqtkdmnggvisfqelekvhfrklnvglddleksid
    mlkslecfeifqirgkkflrsvpneltsdqtkileicsilgyssisllkanlgweavrsk
    saldemvangllwidyqggaealywdpswitrq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u5tB (B:)
    ldrekflnkelfldeiareiyeftlsefkdlnsdtnymiitlvdlyamynksmrigtgli
    spmemreacerfehlglnelklvkvnkrilcvtsekfdvvkeklvdligdnpgsdllrlt
    qilssnnsksnwtlgilmevlqncvdegdllidkqlsgiyyyknsywps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u5tC (C:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindnelds
    gstdnddskkisknlfnnediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttr
    yfilwksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkpl
    cdrnratmlkdendkviaikvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5tC (C:)
    salppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtsknlfnnedi
    qrsvsqvfideiwsqmtkegkclpidqsgrrssnttttryfilwksldswaslilqwfed
    sgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnratmlkdendkviai
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u5tD (D:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindnelds
    gstdnddskkisknlfnnediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttr
    yfilwksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkpl
    cdrnratmlkdendkviaikvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5tD (D:)
    salppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtsknlfnnedi
    qrsvsqvfideiwsqmtkegkclpidqsgrrssnttttryfilwksldswaslilqwfed
    sgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnratmlkdendkviai