PDB entry 1u5s

View 1u5s on RCSB PDB site
Description: NMR structure of the complex between Nck-2 SH3 domain and PINCH-1 LIM4 domain
Class: metal binding protein
Keywords: Protein-protein complex, beta barrel, beta sheet, zinc finger
Deposited on 2004-07-28, released 2005-04-05
The last revision prior to the SCOP 1.75 freeze date was dated 2005-04-05, with a file datestamp of 2007-06-04.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic protein NCK2
    Species: HOMO SAPIENS
    Gene: NCK2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1u5sa1
  • Chain 'B':
    Compound: PINCH protein
    Species: HOMO SAPIENS
    Gene: LIMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48059 (2-65)
      • cloning artifact (0-1)
    Domains in SCOP 1.75: d1u5sb1, d1u5sb2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u5sA (A:)
    qgsrvlhvvqtlypfssvteeelnfekgetmeviekpendpewwkcknargqvglvpkny
    vvvlsdgpalh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u5sB (B:)
    gsmgvpicgacrrpiegrvvnamgkqwhvehfvcakcekpflghrhyerkglaycethyn
    qlfgdv