PDB entry 1u5r

View 1u5r on RCSB PDB site
Description: Crystal Structure of the TAO2 Kinase Domain: Activation and Specifity of a Ste20p MAP3K
Deposited on 2004-07-28, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.211
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u5ra_
  • Chain 'B':
    Domains in SCOP 1.71: d1u5rb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5rA (A:)
    msyyhhhhhhdydipttenlyfqgamdpmpaggragslkdpdvaelffkddpeklfsdlr
    eighgsfgavyfardvrnsevvaikkmsysgkqsnekwqdiikevrflqklrhpntiqyr
    gcylrehtawlvmeyclgsasdllevhkkplqeveiaavthgalqglaylhshnmihrdv
    kagnillsepglvklgdfgsasimapansfvgtpywmapevilamdegqydgkvdvwslg
    itcielaerkpplfnmnamsalyhiaqnespalqsghwseyfrnfvdsclqkipqdrpts
    evllkhrfvlrerpptvimdliqrtkdavreldnlqyrkmkkilfqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5rA (A:)
    dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
    diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
    thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
    evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
    eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
    mkkilfqea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5rB (B:)
    msyyhhhhhhdydipttenlyfqgamdpmpaggragslkdpdvaelffkddpeklfsdlr
    eighgsfgavyfardvrnsevvaikkmsysgkqsnekwqdiikevrflqklrhpntiqyr
    gcylrehtawlvmeyclgsasdllevhkkplqeveiaavthgalqglaylhshnmihrdv
    kagnillsepglvklgdfgsasimapansfvgtpywmapevilamdegqydgkvdvwslg
    itcielaerkpplfnmnamsalyhiaqnespalqsghwseyfrnfvdsclqkipqdrpts
    evllkhrfvlrerpptvimdliqrtkdavreldnlqyrkmkkilfqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5rB (B:)
    dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
    diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
    thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
    evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
    eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
    mkkilfqea