PDB entry 1u5q

View 1u5q on RCSB PDB site
Description: Crystal Structure of the TAO2 Kinase Domain: Activation and Specifity of a Ste20p MAP3K
Class: transferase
Keywords: serine/threonine protein kinase, TRANSFERASE
Deposited on 2004-07-28, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine protein kinase TAO2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: serine/threonine protein kinase TAO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLS3 (Start-347)
      • modified residue (208)
    Domains in SCOPe 2.07: d1u5qa_
  • Chain 'B':
    Compound: serine/threonine protein kinase TAO2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: serine/threonine protein kinase TAO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLS3 (Start-347)
      • modified residue (208)
    Domains in SCOPe 2.07: d1u5qb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5qA (A:)
    msyyhhhhhhdydipttenlyfqgamdpmpaggragslkdpdvaelffkddpeklfsdlr
    eighgsfgavyfardvrnsevvaikkmsysgkqsnekwqdiikevrflqklrhpntiqyr
    gcylrehtawlvmeyclgsasdllevhkkplqeveiaavthgalqglaylhshnmihrdv
    kagnillsepglvklgdfgsasimapansfvgtpywmapevilamdegqydgkvdvwslg
    itcielaerkpplfnmnamsalyhiaqnespalqsghwseyfrnfvdsclqkipqdrpts
    evllkhrfvlrerpptvimdliqrtkdavreldnlqyrkmkkilfqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5qA (A:)
    dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
    diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
    thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
    evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
    eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
    mkkilfqea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5qB (B:)
    msyyhhhhhhdydipttenlyfqgamdpmpaggragslkdpdvaelffkddpeklfsdlr
    eighgsfgavyfardvrnsevvaikkmsysgkqsnekwqdiikevrflqklrhpntiqyr
    gcylrehtawlvmeyclgsasdllevhkkplqeveiaavthgalqglaylhshnmihrdv
    kagnillsepglvklgdfgsasimapansfvgtpywmapevilamdegqydgkvdvwslg
    itcielaerkpplfnmnamsalyhiaqnespalqsghwseyfrnfvdsclqkipqdrpts
    evllkhrfvlrerpptvimdliqrtkdavreldnlqyrkmkkilfqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5qB (B:)
    dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
    diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
    thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
    evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
    eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
    mkkilfqea