PDB entry 1u5p

View 1u5p on RCSB PDB site
Description: Crystal Structure of Repeats 15 and 16 of Chicken Brain Alpha Spectrin
Class: structural protein
Keywords: alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, STRUCTURAL PROTEIN
Deposited on 2004-07-28, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u5pa1, d1u5pa2
  • Heterogens: K, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5pA (A:)
    mankqqnfntgikdfdfwlseveallasedygkdlasvnnllkkhqlleadisahedrlk
    dlnsqadslmtssafdtsqvkdkretingrfqriksmaaarraklneshrlhqffrdmdd
    eeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldtgkklsddnt
    igkeeiqqrlaqfvdhwkelkqlaaargqrleesle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5pA (A:)
    ankqqnfntgikdfdfwlseveallasedygkdlasvnnllkkhqlleadisahedrlkd
    lnsqadslmtssafdtsqvkdkretingrfqriksmaaarraklneshrlhqffrdmdde
    eswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldtgkklsddnti
    gkeeiqqrlaqfvdhwkelkqlaaargqrle