PDB entry 1u5o

View 1u5o on RCSB PDB site
Description: structure of the d23a mutant of the nuclear transport carrier ntf2
Deposited on 2004-07-28, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u5oa_
  • Chain 'B':
    Domains in SCOP 1.71: d1u5ob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5oA (A:)
    mgdkpiweqigssfiqhyyqlfandrtqlgaiyidascltwegqqfqgkaaiveklsslp
    fqkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfr
    lalhnfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5oA (A:)
    gdkpiweqigssfiqhyyqlfandrtqlgaiyidascltwegqqfqgkaaiveklsslpf
    qkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrl
    alhnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5oB (B:)
    mgdkpiweqigssfiqhyyqlfandrtqlgaiyidascltwegqqfqgkaaiveklsslp
    fqkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfr
    lalhnfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5oB (B:)
    kpiweqigssfiqhyyqlfandrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
    iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
    h