PDB entry 1u5m

View 1u5m on RCSB PDB site
Description: Structure of a Chordin-like Cysteine-rich Repeat (VWC module) from Collagen IIA
Class: structural protein
Keywords: 5 disulfide bonds, two sub-domain architecture, beta-sheet, STRUCTURAL PROTEIN
Deposited on 2004-07-28, released 2004-10-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha 1 type II collagen isoform 1
    Species: Homo sapiens [TaxId:9606]
    Gene: COL2A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02458 (0-72)
      • cloning artifact (0-3)
      • engineered (66)
      • engineered (70)
      • engineered (72)
    Domains in SCOPe 2.02: d1u5ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u5mA (A:)
    yvefqeagscvqdgqryndkdvwkpepcricvcdtgtvlcddiicedvkdclspeipfge
    ccpicpadlaaaa