PDB entry 1u5m

View 1u5m on RCSB PDB site
Description: Structure of a Chordin-like Cysteine-rich Repeat (VWC module) from Collagen IIA
Class: structural protein
Keywords: 5 disulfide bonds, two sub-domain architecture, beta-sheet
Deposited on 2004-07-28, released 2004-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2006-01-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha 1 type II collagen isoform 1
  Species: HOMO SAPIENS
  Gene: COL2A1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02458 (0-72)
    • cloning artifact (0-3)
    • engineered (66)
    • engineered (70)
    • engineered (72)
  Domains in SCOP 1.75: d1u5ma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u5mA (A:)
  yvefqeagscvqdgqryndkdvwkpepcricvcdtgtvlcddiicedvkdclspeipfge
  ccpicpadlaaaa