PDB entry 1u5l

View 1u5l on RCSB PDB site
Description: solution structure of the turtle prion protein fragment (121-226)
Deposited on 2004-07-28, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u5la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5lA (A:)
    gsvvgglggyalgsamsgmrmnfdrpeerqwwnensnrypnqvyykeyndrsvpegrfvr
    dcvnitvteykidpnenqnvtqvevrvmkqviqemcmqqyqqyqlasg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5lA (A:)
    gsvvgglggyalgsamsgmrmnfdrpeerqwwnensnrypnqvyykeyndrsvpegrfvr
    dcvnitvteykidpnenqnvtqvevrvmkqviqemcmqqyqqyqlas