PDB entry 1u5l

View 1u5l on RCSB PDB site
Description: Solution Structure of the turtle prion protein fragment (121-226)
Class: membrane protein
Keywords: Prnp, PrP, prion, TSE, MEMBRANE PROTEIN
Deposited on 2004-07-28, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Trachemys scripta [TaxId:34903]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I9C0 (2-End)
      • cloning artifact (0-1)
      • see remark 999 (62)
      • see remark 999 (64)
    Domains in SCOPe 2.07: d1u5la1, d1u5la2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5lA (A:)
    gsvvgglggyalgsamsgmrmnfdrpeerqwwnensnrypnqvyykeyndrsvpegrfvr
    dcvnitvteykidpnenqnvtqvevrvmkqviqemcmqqyqqyqlasg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5lA (A:)
    gsvvgglggyalgsamsgmrmnfdrpeerqwwnensnrypnqvyykeyndrsvpegrfvr
    dcvnitvteykidpnenqnvtqvevrvmkqviqemcmqqyqqyqlas