PDB entry 1u5k

View 1u5k on RCSB PDB site
Description: Recombinational repair protein RecO
Class: recombination,replication
Keywords: OBD-fold, Zn-binding, RECOMBINATION,REPLICATION
Deposited on 2004-07-27, released 2004-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR0819
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u5ka1, d1u5ka2
  • Chain 'B':
    Compound: hypothetical protein
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR0819
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u5kb1, d1u5kb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5kA (A:)
    mrsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqv
    yqgphndlasvkqavlegalptlaeperyafahlmaefadalfqegefseqafdlfaasl
    rgvahqpdpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalp
    pyppavldflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvpsgv
    pvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5kA (A:)
    rsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqvy
    qgphdlasvkqavlegalptlaeperyafahlmaefadalfqegefseqafdlfaaslrg
    vahqpdpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalppy
    ppavldflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvpsgvpv
    ls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5kB (B:)
    mrsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqv
    yqgphndlasvkqavlegalptlaeperyafahlmaefadalfqegefseqafdlfaasl
    rgvahqpdpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalp
    pyppavldflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvpsgv
    pvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5kB (B:)
    mrsrtanrsgivirrrvtpagdiivtlltpqgklkaiargplssslnlfhhvgvqvyqgp
    hndlasvkqavlegalptlaeperyafahlmaefadalfqgefseqafdlfaaslrgvah
    qpdpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalppyppa
    vldflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvp