PDB entry 1u5k

View 1u5k on RCSB PDB site
Description: Recombinational repair protein RecO
Deposited on 2004-07-27, released 2004-10-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-26, with a file datestamp of 2004-10-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5kA (A:)
    mrsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqv
    yqgphndlasvkqavlegalptlaeperyafahlmaefadalfqegefseqafdlfaasl
    rgvahqpdpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalp
    pyppavldflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvpsgv
    pvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5kA (A:)
    rsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqvy
    qgphdlasvkqavlegalptlaeperyafahlmaefadalfqegefseqafdlfaaslrg
    vahqpdpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalppy
    ppavldflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvpsgvpv
    ls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5kB (B:)
    mrsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqv
    yqgphndlasvkqavlegalptlaeperyafahlmaefadalfqegefseqafdlfaasl
    rgvahqpdpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalp
    pyppavldflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvpsgv
    pvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5kB (B:)
    mrsrtanrsgivirrrvtpagdiivtlltpqgklkaiargplssslnlfhhvgvqvyqgp
    hndlasvkqavlegalptlaeperyafahlmaefadalfqgefseqafdlfaaslrgvah
    qpdpewvalvmsykllglagvipqtarcarcgapdpehpdplggqllcskcaalppyppa
    vldflrhavrrtvrasfeqpvpsadrpalwralekfvtvqvggvhswrqlvp