PDB entry 1u5j

View 1u5j on RCSB PDB site
Description: propionibacterium shermanii transcarboxylase 5s subunit, met186ile
Deposited on 2004-07-27, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5jA (A:)
    maisrelvdpnsspreievseprevgitelvlrdahqslmatrmamedmvgacadidaag
    ywsvecwggatydscirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvd
    rfvdksaengmdvfrvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvkl
    agqlldmgadsialkdiaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmk
    aieagvdvvdtaissmslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpky
    kkfesktlvdtsifksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvt
    pssqivgtqavfnvmmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitq
    rpadllppewekqskeaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaq
    lkaeaegdekslavagpvtynvnvggtvrevtvqqatrasqpelapedpedlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5jA (A:)
    reievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggatyds
    cirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdvf
    rvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsial
    kdiaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtais
    smslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsif
    ksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfnv
    mmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekqs
    keaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea