PDB entry 1u5f

View 1u5f on RCSB PDB site
Description: Crystal Structure of the PH Domain of SKAP-Hom with 8 Vector-derived N-terminal Residues
Class: signaling protein
Keywords: PH domain of SKAP-Hom, Artefactual dimerization induced by vector-derived sequence, SIGNALING PROTEIN
Deposited on 2004-07-27, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.227
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Src-associated adaptor protein
    Species: Mus musculus [TaxId:10090]
    Gene: SCAP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BK74 (8-End)
      • see remark 999 (8)
      • see remark 999 (8)
      • see remark 999 (8)
      • see remark 999 (8)
      • see remark 999 (8)
      • see remark 999 (8)
      • engineered (9)
    Domains in SCOPe 2.06: d1u5fa1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5fA (A:)
    rasvgspgipaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqq
    kgefaidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqd
    lgsdvipeddeergelyddvdhpaavss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5fA (A:)
    rasvgspgipaqdlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqq
    kgefaidgydvrmnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilq