PDB entry 1u5e

View 1u5e on RCSB PDB site
Description: Crystal Structure of a N-terminal Fragment of SKAP-Hom Containing Both the Helical Dimerization Domain and the PH Domain
Class: signaling protein
Keywords: Novel Dimerization Domain, PH Domain, SIGNALING PROTEIN
Deposited on 2004-07-27, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.181
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Src-associated adaptor protein
    Species: Mus musculus [TaxId:10090]
    Gene: SCAP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z2K4 (0-210)
      • engineered (0-1)
    Domains in SCOPe 2.06: d1u5ea1
  • Chain 'B':
    Compound: Src-associated adaptor protein
    Species: Mus musculus [TaxId:10090]
    Gene: SCAP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u5eb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5eA (A:)
    gspeeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqdkgdaed
    gdeyddpfagpadtislaserydkdddgpsdgnqfppiaaqdlpfvikagylekrrkdhs
    flgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmnntlrkdgkkdccfeica
    pdkriyqftaaspkdaeewvqqlkfilqdlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5eA (A:)
    gspeeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqfppiaaq
    dlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvr
    mnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5eB (B:)
    gspeeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqdkgdaed
    gdeyddpfagpadtislaserydkdddgpsdgnqfppiaaqdlpfvikagylekrrkdhs
    flgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmnntlrkdgkkdccfeica
    pdkriyqftaaspkdaeewvqqlkfilqdlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5eB (B:)
    peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqfppiaaqdl
    pfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmn
    ntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg