PDB entry 1u5d

View 1u5d on RCSB PDB site
Description: Crystal Structure of the PH domain of SKAP55
Class: signaling protein
Keywords: PH Domain
Deposited on 2004-07-27, released 2005-07-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.168
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Src Kinase-associated Phosphoprotein of 55 kDa
    Species: HOMO SAPIENS
    Gene: HSSKAP55
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15268 (0-107)
      • engineered (0-1)
    Domains in SCOP 1.73: d1u5da1
  • Chain 'B':
    Compound: Src Kinase-associated Phosphoprotein of 55 kDa
    Species: HOMO SAPIENS
    Gene: HSSKAP55
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15268 (0-End)
      • engineered (0-1)
    Domains in SCOP 1.73: d1u5db1
  • Chain 'C':
    Compound: Src Kinase-associated Phosphoprotein of 55 kDa
    Species: HOMO SAPIENS
    Gene: HSSKAP55
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15268 (0-End)
      • engineered (0-1)
    Domains in SCOP 1.73: d1u5dc1
  • Chain 'D':
    Compound: Src Kinase-associated Phosphoprotein of 55 kDa
    Species: HOMO SAPIENS
    Gene: HSSKAP55
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15268 (0-107)
      • engineered (0-1)
    Domains in SCOP 1.73: d1u5dd1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u5dA (A:)
    gsvikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrma
    phlrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5dB (B:)
    gsvikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrma
    phlrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5dB (B:)
    gsvikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrma
    phlrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u5dC (C:)
    gsvikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrma
    phlrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5dC (C:)
    gsvikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrma
    phlrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u5dD (D:)
    gsvikqgylekkskdhsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvrma
    phlrrdskkescfeltsqdrrtyeftatspaeardwvdqisfllkdls