PDB entry 1u5b

View 1u5b on RCSB PDB site
Description: Crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase,ketoacid dehydrogenase, branched-chain, multi-enzyme complex, acylation, oxidative decarboxylation maple syrup urine disease, thiamin diphosphate, phosphorylation, flavoprotein, oxidoreductase
Deposited on 2004-07-27, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.156
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: BCKDHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u5ba_
  • Chain 'B':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: BCKDHB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u5bb1, d1u5bb2
  • Heterogens: K, MN, TDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5bA (A:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssay
    rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5bA (A:)
    kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt
    llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp
    lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr
    vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg
    ygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssayrvnyw
    dkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyq
    empaqlrkqqeslarhlqtygehypldhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5bB (B:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5bB (B:)
    eygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkdrvfntp
    lceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfncgsltir
    spwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpciffepkil
    yraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevid
    lrtiipwdvdticksviktgrllisheapltggfaseisstvqeecflnleapisrvcgy
    dtpfphifepfyipdkwkcydalrkminy