PDB entry 1u5a

View 1u5a on RCSB PDB site
Description: Plasmodium falciparum lactate dehydrogenase complexed with 3,5-dihydroxy-2-naphthoic acid
Class: oxidoreductase
Keywords: Protein-ligand complex, OXIDOREDUCTASE
Deposited on 2004-07-27, released 2005-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.147
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: lactate dehydrogenase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27743 (0-End)
      • expression tag (315)
    Domains in SCOPe 2.06: d1u5aa1, d1u5aa2, d1u5aa3
  • Heterogens: BIK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5aA (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
    iivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaa
    aiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekak
    fdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5aA (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftkrddllplnnkimieigghikkncpnafiivvtnpvdv
    mvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkr
    yitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesyl
    kdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetkr
    mkalah