PDB entry 1u59

View 1u59 on RCSB PDB site
Description: crystal structure of the zap-70 kinase domain in complex with staurosporine
Deposited on 2004-07-27, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1u59a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u59A (A:)
    dkklflkrdnlliadielgcgnfgsvrqgvyrmrkkqidvaikvlkqgtekadteemmre
    aqimhqldnpyivrligvcqaealmlvmemagggplhkflvgkreeipvsnvaellhqvs
    mgmkyleeknfvhrdlaarnvllvnrhyakisdfglskalgaddsyytarsagkwplkwy
    apecinfrkfssrsdvwsygvtmwealsygqkpykkmkgpevmafieqgkrmecppecpp
    elyalmsdcwiykwedrpdfltveqrmracyyslaskveghhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u59A (A:)
    kklflkrdnlliadielgcgnfgsvrqgvyrkqidvaikvlkqgtekadteemmreaqim
    hqldnpyivrligvcqaealmlvmemagggplhkflvgkreeipvsnvaellhqvsmgmk
    yleeknfvhrdlaarnvllvnrhyakisdfglskalgaddsyytarsagkwplkwyapec
    infrkfssrsdvwsygvtmwealsygqkpykkmkgpevmafieqgkrmecppecppelya
    lmsdcwiykwedrpdfltveqrmracyyslaskveghhhhhh