PDB entry 1u59

View 1u59 on RCSB PDB site
Description: Crystal Structure of the ZAP-70 Kinase Domain in Complex with Staurosporine
Class: transferase
Keywords: transferase
Deposited on 2004-07-27, released 2004-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase zap-70
    Species: Homo sapiens [TaxId:9606]
    Gene: ZAP70, SRK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43403 (Start-279)
      • expression tag (280-285)
    Domains in SCOPe 2.08: d1u59a1, d1u59a2
  • Heterogens: STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u59A (A:)
    dkklflkrdnlliadielgcgnfgsvrqgvyrmrkkqidvaikvlkqgtekadteemmre
    aqimhqldnpyivrligvcqaealmlvmemagggplhkflvgkreeipvsnvaellhqvs
    mgmkyleeknfvhrdlaarnvllvnrhyakisdfglskalgaddsyytarsagkwplkwy
    apecinfrkfssrsdvwsygvtmwealsygqkpykkmkgpevmafieqgkrmecppecpp
    elyalmsdcwiykwedrpdfltveqrmracyyslaskveghhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u59A (A:)
    kklflkrdnlliadielgcgnfgsvrqgvyrkqidvaikvlkqgtekadteemmreaqim
    hqldnpyivrligvcqaealmlvmemagggplhkflvgkreeipvsnvaellhqvsmgmk
    yleeknfvhrdlaarnvllvnrhyakisdfglskalgaddsyytarsagkwplkwyapec
    infrkfssrsdvwsygvtmwealsygqkpykkmkgpevmafieqgkrmecppecppelya
    lmsdcwiykwedrpdfltveqrmracyyslaskveghhhhhh