PDB entry 1u54

View 1u54 on RCSB PDB site
Description: Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the CDC42-associated Tyrosine Kinase ACK1 bound to AMP-PCP
Class: transferase
Keywords: Tyrosine Kinase
Deposited on 2004-07-26, released 2004-08-31
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activated CDC42 kinase 1
    Species: HOMO SAPIENS
    Gene: ACK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07912
      • modified residue (177)
    Domains in SCOP 1.73: d1u54a_
  • Chain 'B':
    Compound: Activated CDC42 kinase 1
    Species: HOMO SAPIENS
    Gene: ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u54b_
  • Heterogens: MG, ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u54A (A:)
    gsagegplqsltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvls
    qpeamddfirevnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfll
    gtlsryavqvaegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvm
    qehrkvpfawcapeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidke
    gerlprpedcpqdiynvmvqcwahkpedrptfvalrdflleaqptdmraef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u54A (A:)
    qsltcligekdlrlleklgdgvvrrgewdapsgktvsvavkclamddfirevnamhsldh
    rnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgylesk
    rfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrvpfawcapeslktrtf
    shasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqc
    wahkpedrptfvalrdflleaqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u54B (B:)
    gsagegplqsltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvls
    qpeamddfirevnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfll
    gtlsryavqvaegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvm
    qehrkvpfawcapeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidke
    gerlprpedcpqdiynvmvqcwahkpedrptfvalrdflleaqptdmraef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u54B (B:)
    ltcligekdlrlleklgdgvvrrgewdapsgktvsvavkcleamddfirevnamhsldhr
    nlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgyleskr
    fihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapeslktrtf
    shasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqc
    wahkpedrptfvalrdfllea