PDB entry 1u53

View 1u53 on RCSB PDB site
Description: novel x-ray structure of na-asp-2, a pr-1 protein from the nematode parasite necator americanus and a vaccine antigen for human hookworm infection
Deposited on 2004-07-26, released 2005-02-01
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: secreted protein ASP-2
    Species: Necator americanus [TaxId:51031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Z1H1 (Start-195)
      • cloning artifact (3-4)
      • see remark 999 (22)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1u53A (A:)
    aeaefgcpdngmseearqkflemhnslrssvalgqakdgaggnapkaakmktmaydceve
    ktamnnakqcvfkhsqpnqrkglgenifmssdsgmdkakaaeqaskawfgelaekgvgqn
    lkltgglfsrgvghytqmvwqetvklgcyveacsnmcyvvcqygpagnmmgkdiyekgep
    cskcencdkekglcsa
    

    Sequence, based on observed residues (ATOM records):
    >1u53A (A:)
    efgcpdngmseearqkflemhnslrssvalgqakdgaggnapkaakmktmaydcevekta
    mnnakqcvfkhsqpnqrkglgenifmssdsgmdkakaaeqaskawfgelaekgvgqnlkl
    tgglfsrgvghytqmvwqetvklgcyveacsnmcyvvcqygpagnmmgkdiyekgepcsk
    cencdkekglcsa