PDB entry 1u4r

View 1u4r on RCSB PDB site
Description: crystal structure of human rantes mutant 44-aana-47
Deposited on 2004-07-26, released 2004-11-09
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-09, with a file datestamp of 2004-11-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u4ra_
  • Chain 'B':
    Domains in SCOP 1.71: d1u4rb_
  • Chain 'C':
    Domains in SCOP 1.71: d1u4rc_
  • Chain 'D':
    Domains in SCOP 1.71: d1u4rd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4rA (A:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4rA (A:)
    ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtnaqvcanpekkwvreyinsl
    em
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u4rB (B:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvre
    yinslems
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u4rC (C:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4rC (C:)
    sdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvreyins
    lems
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u4rD (D:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvre
    yinslems