PDB entry 1u4r

View 1u4r on RCSB PDB site
Description: Crystal Structure of human RANTES mutant 44-AANA-47
Class: attractant
Keywords: chemoattractant, cytokine, chemokine, rantes, mutant, glycosaminoglycan, protein-heparin disaccharide complex
Deposited on 2004-07-26, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small inducible cytokine A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501
      • engineered (46)
    Domains in SCOPe 2.07: d1u4ra_
  • Chain 'B':
    Compound: Small inducible cytokine A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (0-67)
      • engineered (43-44)
      • engineered (46)
    Domains in SCOPe 2.07: d1u4rb_
  • Chain 'C':
    Compound: Small inducible cytokine A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (Start-67)
      • engineered (43-44)
      • engineered (46)
    Domains in SCOPe 2.07: d1u4rc_
  • Chain 'D':
    Compound: Small inducible cytokine A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (0-67)
      • engineered (43-44)
      • engineered (46)
    Domains in SCOPe 2.07: d1u4rd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4rA (A:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4rA (A:)
    ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtnaqvcanpekkwvreyinsl
    em
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u4rB (B:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvre
    yinslems
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u4rC (C:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4rC (C:)
    sdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvreyins
    lems
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u4rD (D:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvre
    yinslems