PDB entry 1u4q

View 1u4q on RCSB PDB site
Description: Crystal Structure of Repeats 15, 16 and 17 of Chicken Brain Alpha Spectrin
Class: structural protein
Keywords: alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, STRUCTURAL PROTEIN
Deposited on 2004-07-26, released 2004-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u4qa1, d1u4qa2, d1u4qa3
  • Chain 'B':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u4qb1, d1u4qb2, d1u4qb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4qA (A:)
    mankqqnfntgikdfdfwlseveallasedygkdlasvnnllkkhqlleadisahedrlk
    dlnsqadslmtssafdtsqvkdkretingrfqriksmaaarraklneshrlhqffrdmdd
    eeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldtgkklsddnt
    igkeeiqqrlaqfvdhwkelkqlaaargqrleesleyqqfvanveeeeawinekmtlvas
    edygdtlaaiqgllkkheafetdftvhkdrvndvcangedlikknnhhvenitakmkglk
    gkvsdlekaaaqrkakldensa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4qA (A:)
    ankqqnfntgikdfdfwlseveallasedygkdlasvnnllkkhqlleadisahedrlkd
    lnsqadslmtssafdtsqvkdkretingrfqriksmaaarraklneshrlhqffrdmdde
    eswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldtgkklsddnti
    gkeeiqqrlaqfvdhwkelkqlaaargqrleesleyqqfvanveeeeawinekmtlvase
    dygdtlaaiqgllkkheafetdftvhkdrvndvcangedlikknnhhvenitakmkglkg
    kvsdlekaaaqrkaklde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u4qB (B:)
    mankqqnfntgikdfdfwlseveallasedygkdlasvnnllkkhqlleadisahedrlk
    dlnsqadslmtssafdtsqvkdkretingrfqriksmaaarraklneshrlhqffrdmdd
    eeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldtgkklsddnt
    igkeeiqqrlaqfvdhwkelkqlaaargqrleesleyqqfvanveeeeawinekmtlvas
    edygdtlaaiqgllkkheafetdftvhkdrvndvcangedlikknnhhvenitakmkglk
    gkvsdlekaaaqrkakldensa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4qB (B:)
    qqnfntgikdfdfwlseveallasedygkdlasvnnllkkhqlleadisahedrlkdlns
    qadslmtssafdtsqvkdkretingrfqriksmaaarraklneshrlhqffrdmddeesw
    ikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldtgkklsddntigke
    eiqqrlaqfvdhwkelkqlaaargqrleesleyqqfvanveeeeawinekmtlvasedyg
    dtlaaiqgllkkheafetdftvhkdrvndvcangedlikknnhhvenitakmkglkgkvs
    dlekaaaqrkakldens