PDB entry 1u4p

View 1u4p on RCSB PDB site
Description: Crystal Structure of human RANTES mutant K45E
Class: attractant
Keywords: chemoattractant, cytokine, chemokine, rantes, mutant, glycosaminoglycan, protein-heparin disaccharide complex
Deposited on 2004-07-26, released 2004-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.206
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small inducible cytokine A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (0-End)
      • engineered (44)
    Domains in SCOPe 2.08: d1u4pa_
  • Chain 'B':
    Compound: Small inducible cytokine A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501
      • engineered (44)
    Domains in SCOPe 2.08: d1u4pb_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4pA (A:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrenrqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4pA (A:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrenrqvcanpekkwvre
    yinslem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u4pB (B:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrenrqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4pB (B:)
    pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrenrqvcanpekkwvrey
    inslem