PDB entry 1u4n

View 1u4n on RCSB PDB site
Description: Crystal Structure Analysis of the M211S/R215L EST2 mutant
Class: hydrolase
Keywords: alpha/beta hydrolase fold, hydrolase
Deposited on 2004-07-26, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxylesterase est2
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SIG1 (Start-309)
      • engineered mutation (210)
      • engineered mutation (214)
    Domains in SCOPe 2.08: d1u4na_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4nA (A:)
    mpldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdlpgrtl
    kvrmyrpegveppypalvyyhgggwvvgdlethdpvcrvlakdgravvfsvdyrlapehk
    fpaavedaydalqwiaeraadfhldpariavggdsaggnlaavtsilakerggpalafql
    liypstgydpahppasieenaegylltggmslwfldqylnsleelthpwfspvlypdlsg
    lppayiataqydplrdvgklyaealnkagvkveienfedlihgfaqfyslspgatkalvr
    iaeklrdala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4nA (A:)
    ldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdlpgrtlkv
    rmyrpegveppypalvyyhgggwvvgdlethdpvcrvlakdgravvfsvdyrlapehkfp
    aavedaydalqwiaeraadfhldpariavggdsaggnlaavtsilakerggpalafqlli
    ypstgydpahppasieenaegylltggmslwfldqylnsleelthpwfspvlypdlsglp
    payiataqydplrdvgklyaealnkagvkveienfedlihgfaqfyslspgatkalvria
    eklrdala