PDB entry 1u4m

View 1u4m on RCSB PDB site
Description: human RANTES complexed to heparin-derived disaccharide III-S
Class: attractant
Keywords: chemoattractant, cytokine, chemokine, rantes, glycosaminoglycan, protein-heparin disaccharide complex
Deposited on 2004-07-26, released 2004-11-09
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small inducible cytokine A5
    Species: HOMO SAPIENS
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u4ma_
  • Chain 'B':
    Compound: Small inducible cytokine A5
    Species: HOMO SAPIENS
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u4mb_
  • Heterogens: H3S, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4mA (A:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4mA (A:)
    pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
    inslems
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u4mB (B:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4mB (B:)
    ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
    slems