PDB entry 1u4l

View 1u4l on RCSB PDB site
Description: human RANTES complexed to heparin-derived disaccharide I-S
Class: attractant
Keywords: CHEMOATTRACTANT, CYTOKINE, CHEMOKINE, RANTES, GLYCOSAMINOGLYCAN, PROTEIN-HEPARIN DISACCHARIDE COMPLEX, attractant
Deposited on 2004-07-26, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small inducible cytokine A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u4la_
  • Chain 'B':
    Compound: Small inducible cytokine A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u4lb_
  • Heterogens: H1S, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4lA (A:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4lA (A:)
    pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
    inslems
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u4lB (B:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4lB (B:)
    ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
    slems