PDB entry 1u4j

View 1u4j on RCSB PDB site
Description: crystal structure of a carbohydrate induced dimer of group i phospholipase a2 from bungarus caeruleus at 2.1 a resolution
Deposited on 2004-07-26, released 2004-08-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u4ja_
  • Chain 'B':
    Domains in SCOP 1.71: d1u4jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1u4jA (A:)
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1u4jB (B:)
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq