PDB entry 1u4i

View 1u4i on RCSB PDB site
Description: Solution Structure of Rhodostomin D51E Mutant
Class: hydrolase
Keywords: antiparallel beta sheets
Deposited on 2004-07-25, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-05-08, with a file datestamp of 2007-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hemorrhagic protein-rhodostomin
  Species: Saccharomyces cerevisiae
  Gene: Calloselasma rhodostoma
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30403 (0-67)
    • engineered (50)
  Domains in SCOPe 2.07: d1u4ia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u4iA (A:)
  gkecdcsspenpccdaatcklrpgaqcgeglcceqckfsragkicriprgempddrctgq
  sadcpryh