PDB entry 1u4h

View 1u4h on RCSB PDB site
Description: Crystal structure of an oxygen binding H-NOX domain related to soluble guanylate cyclases (oxygen complex)
Class: signaling protein
Keywords: h-nox domain, heme, oxygen sensor, signal transduction, chemotaxis, signaling protein
Deposited on 2004-07-25, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.216
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme-based Methyl-accepting Chemotaxis Protein
    Species: Thermoanaerobacter tengcongensis [TaxId:119072]
    Gene: Tar4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RBX6 (0-187)
      • modified residue (0)
      • modified residue (95-97)
      • modified residue (107)
      • modified residue (128)
      • modified residue (136)
    Domains in SCOPe 2.07: d1u4ha_
  • Chain 'B':
    Compound: Heme-based Methyl-accepting Chemotaxis Protein
    Species: Thermoanaerobacter tengcongensis [TaxId:119072]
    Gene: Tar4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RBX6 (0-187)
      • modified residue (0)
      • modified residue (95-97)
      • modified residue (107)
      • modified residue (128)
      • modified residue (136)
    Domains in SCOPe 2.07: d1u4hb_
  • Heterogens: SCN, HEM, OXY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u4hA (A:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u4hB (B:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn