PDB entry 1u4g

View 1u4g on RCSB PDB site
Description: Elastase of Pseudomonas aeruginosa with an inhibitor
Class: hydrolase
Keywords: x-ray structure; Elastase; inhibition; peptidase family M4, HYDROLASE
Deposited on 2004-07-25, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.18
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elastase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u4ga_
  • Heterogens: ZN, CA, SO4, HPI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4gA (A:)
    aeaggpggnqkigkytygsdygplivndrcemddgnvitvdmnsstddskttpfrfacpt
    ntykqvngaysplndahffggvvfklyrdwfgtsplthklymkvhygrsvenaywdgtam
    lfgdgatmfyplvsldvaahevshgfteqnsgliyrgqsggmneafsdmageaaefymrg
    kndfligydikkgsgalrymdqpsrdgrsidnasqyyngidvhhssgvynrafyllansp
    gwdtrkafevfvdanryywtatsnynsgacgvirsaqnrnysaadvtrafstvgvtcpsa
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4gA (A:)
    aeaggpggnqkigkytygsdygplivndrcemddgnvitvdmnsstddskttpfrfacpt
    ntykqvngaysplndahffggvvfklyrdwfgtsplthklymkvhygrsvenaywdgtam
    lfgdgatmfyplvsldvaahevshgfteqnsgliyrgqsggmneafsdmageaaefymrg
    kndfligydikkgsgalrymdqpsrdgrsidnasqyyngidvhhssgvynrafyllansp
    gwdtrkafevfvdanryywtatsnynsgacgvirsaqnrnysaadvtrafstvgvtcp