PDB entry 1u4f

View 1u4f on RCSB PDB site
Description: Crystal Structure of Cytoplasmic Domains of IRK1 (Kir2.1) channel
Class: allergen
Keywords: cytoplasmic domain, Kir2.1, IRK1, inwardly rectifying K channel, rectification, ALLERGEN
Deposited on 2004-07-24, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj2, Irk1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u4fa_
  • Chain 'B':
    Compound: Inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj2, Irk1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u4fb_
  • Chain 'C':
    Compound: Inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj2, Irk1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u4fc_
  • Chain 'D':
    Compound: Inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj2, Irk1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u4fd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4fA (A:)
    prgshgqqcrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlr
    kshlveahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsp
    lydlskqdidnadfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyyk
    vdysrfhktyevpntplcsardlaekkyilsnansfcyenevaltskeeeedsengvpes
    tstdsppgidlhnqasvpleprplrresei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4fA (A:)
    srfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlrkshlveahvr
    aqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdid
    nadfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyykvdysrfhkty
    evpntplcsardlaekk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u4fB (B:)
    prgshgqqcrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlr
    kshlveahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsp
    lydlskqdidnadfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyyk
    vdysrfhktyevpntplcsardlaekkyilsnansfcyenevaltskeeeedsengvpes
    tstdsppgidlhnqasvpleprplrresei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4fB (B:)
    srfvkkdghcnvqfinvgenetlvfshnaviamrdgklclmwrvgnlrkshlveahvraq
    llksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdidna
    dfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyykvdysrfhktyev
    pntplcsardlaekk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u4fC (C:)
    prgshgqqcrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlr
    kshlveahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsp
    lydlskqdidnadfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyyk
    vdysrfhktyevpntplcsardlaekkyilsnansfcyenevaltskeeeedsengvpes
    tstdsppgidlhnqasvpleprplrresei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4fC (C:)
    srfvkkdghcnvqfinvgenetlvfshnaviamrdgklclmwrvgnlrkshlveahvraq
    llksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdidna
    dfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyykvdysrfhktyev
    pntplcsardlaekk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u4fD (D:)
    prgshgqqcrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlr
    kshlveahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsp
    lydlskqdidnadfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyyk
    vdysrfhktyevpntplcsardlaekkyilsnansfcyenevaltskeeeedsengvpes
    tstdsppgidlhnqasvpleprplrresei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4fD (D:)
    srfvkkdghcnvqfinvgektlvfshnaviamrdgklclmwrvgnlrkshlveahvraql
    lksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdidnad
    feivvilegmveatamttqcrssylaneilwghryepvlfeekhyykvdysrfhktyevp
    ntplcsardlaekkyil