PDB entry 1u4d

View 1u4d on RCSB PDB site
Description: Structure of the ACK1 Kinase Domain bound to Debromohymenialdisine
Class: transferase
Keywords: Tyrosine Kinase, TRANSFERASE
Deposited on 2004-07-23, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u4da_
  • Chain 'B':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u4db_
  • Heterogens: CL, DBQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4dA (A:)
    gsagegplqsltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvls
    qpeamddfirevnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfll
    gtlsryavqvaegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvm
    qehrkvpfawcapeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidke
    gerlprpedcpqdiynvmvqcwahkpedrptfvalrdflleaqptdmraef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4dA (A:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkcpeamddfirevnamhsl
    dhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgyle
    skrfihrdlaarnlllatrdlvkigdfglmralpqdhyvmvpfawcapeslktrtfshas
    dtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqcwahk
    pedrptfvalrdflleaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u4dB (B:)
    gsagegplqsltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvls
    qpeamddfirevnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfll
    gtlsryavqvaegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvm
    qehrkvpfawcapeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidke
    gerlprpedcpqdiynvmvqcwahkpedrptfvalrdflleaqptdmraef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4dB (B:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclamddfirevnamhsld
    hrnlirlygvvltppmkmvtelaplgslldrlrkhqllgtlsryavqvaegmgyleskrf
    ihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapeslktrtfs
    hasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqcw
    ahkpedrptfvalrdflleaqp