PDB entry 1u4c

View 1u4c on RCSB PDB site
Description: Structure of spindle checkpoint protein Bub3
Class: cell cycle
Keywords: WD40 protein, WD-40 protein, beta propeller, CELL CYCLE
Deposited on 2004-07-23, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.196
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell cycle arrest protein BUB3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BUB3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26449 (0-End)
      • modified residue (0)
      • modified residue (155)
      • modified residue (166)
    Domains in SCOPe 2.07: d1u4ca_
  • Chain 'B':
    Compound: Cell cycle arrest protein BUB3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BUB3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26449 (0-End)
      • modified residue (0)
      • modified residue (155)
      • modified residue (166)
    Domains in SCOPe 2.07: d1u4cb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4cA (A:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
    hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
    acsdnilclatsddtfktnaaidqtielnassiyiifdyenlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4cA (A:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    ngtieesglkyqirdvallpkeqegyacssidgrvaveffddsskrfafrchrnlaypvn
    siefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdnilclatsddt
    fktnaatielnassiyiifdye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u4cB (B:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
    hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
    acsdnilclatsddtfktnaaidqtielnassiyiifdyenlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4cB (B:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddsskrfafrchrlnlk
    dtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdni
    lclatsddtfktnaatielnassiyiifdye