PDB entry 1u4a

View 1u4a on RCSB PDB site
Description: Solution structure of human SUMO-3 C47S
Class: protein binding
Keywords: beta beta alpha beta beta alpha beta fold, PROTEIN BINDING
Deposited on 2004-07-23, released 2005-03-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein SMT3A
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55854 (0-78)
      • engineered (33)
    Domains in SCOPe 2.05: d1u4aa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4aA (A:)
    ndhinlkvagqdgsvvqfkikrhtplsklmkayserqglsmrqirfrfdgqpinetdtpa
    qlemededtidvfqqqtgglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4aA (A:)
    ndhinlkvagqdgsvvqfkikrhtplsklmkayserqglsmrqirfrfdgqpinetdtpa
    qlemededtidvfqqqtgg