PDB entry 1u43

View 1u43 on RCSB PDB site
Description: IspF with 4-diphosphocytidyl-2c-methyl-D-erythritol 2-phosphate
Class: lyase
Keywords: lyase, MEP pathway, terpene biosynthesis
Deposited on 2004-07-23, released 2004-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.2
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: ispF, mecS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u43a_
  • Heterogens: SUD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u43A (A:)
    mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
    fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
    gchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u43A (A:)
    mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
    fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
    gchmddvnvkattteklgftgrgegiaceavalli