PDB entry 1u3w

View 1u3w on RCSB PDB site
Description: Crystal Structure of Human Alcohol Dehydrogenase Gamma-2-Gamma-2 Isoform Complexed with N-1-Methylheptylformamide Determined to 1.45 Angstrom Resolution
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-07-23, released 2004-10-26
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.185
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alcohol dehydrogenase gamma chain
    Species: HOMO SAPIENS
    Gene: ADH1C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00326 (0-373)
      • see remark 999 (270)
      • see remark 999 (348)
    Domains in SCOP 1.73: d1u3wa1, d1u3wa2
  • Chain 'B':
    Compound: Alcohol dehydrogenase gamma chain
    Species: HOMO SAPIENS
    Gene: ADH1C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00326 (0-373)
      • see remark 999 (270)
      • see remark 999 (348)
    Domains in SCOP 1.73: d1u3wb1, d1u3wb2
  • Heterogens: ZN, NAD, FXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3wA (A:)
    stagkvikckaavlwelkkpfsieevevappkahevrikmvaagicrsdehvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcricknpesnyclkndlgnpr
    gtlqdgtrrftcsgkpihhfvgvstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavkvakvtpgstcavfglggvglsvvmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigqldtmmasllccheacgtsvivgvppdsqn
    lsinpmllltgrtwkgaifggfkskesvpklvadfmakkfsldalitnvlpfekinegfd
    llrsgksirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3wB (B:)
    stagkvikckaavlwelkkpfsieevevappkahevrikmvaagicrsdehvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcricknpesnyclkndlgnpr
    gtlqdgtrrftcsgkpihhfvgvstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavkvakvtpgstcavfglggvglsvvmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigqldtmmasllccheacgtsvivgvppdsqn
    lsinpmllltgrtwkgaifggfkskesvpklvadfmakkfsldalitnvlpfekinegfd
    llrsgksirtvltf