PDB entry 1u3t

View 1u3t on RCSB PDB site
Description: Crystal Structure of Human Alcohol Dehydrogenase Alpha-Alpha Isoform Complexed with N-Cyclopentyl-N-Cyclobutylformamide Determined to 2.5 Angstrom Resolution
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-07-23, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4899999999999998 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alcohol dehydrogenase alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u3ta1, d1u3ta2
  • Chain 'B':
    Compound: Alcohol dehydrogenase alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u3tb1, d1u3tb2
  • Heterogens: ZN, NAD, CCB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3tA (A:)
    stagkvikckaavlwelkkpfsieevevappkahevrikmvavgicgtddhvvsgtmvtp
    lpvilgheaagivesvgegvttvkpgdkviplaipqcgkcricknpesnyclkndvsnpq
    gtlqdgtsrftcrrkpihhflgistfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsaimgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppdsqn
    lsmnpmllltgrtwkgailggfkskecvpklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtilmf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3tB (B:)
    stagkvikckaavlwelkkpfsieevevappkahevrikmvavgicgtddhvvsgtmvtp
    lpvilgheaagivesvgegvttvkpgdkviplaipqcgkcricknpesnyclkndvsnpq
    gtlqdgtsrftcrrkpihhflgistfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsaimgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppdsqn
    lsmnpmllltgrtwkgailggfkskecvpklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtilmf