PDB entry 1u3s

View 1u3s on RCSB PDB site
Description: Crystal Structure of Estrogen Receptor beta complexed with WAY-797
Class: transcription
Keywords: Estrogen Receptor, Estrogen Receptor Beta, ER-beta, ER, Estrogen, Nuclear Receptor, Transcription Factor, Agonist
Deposited on 2004-07-22, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, NR3A2, ESTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u3sa_
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, NR3A2, ESTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u3sb_
  • Chain 'C':
    Compound: steroid receptor coactivator-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1U3S (Start-12)
  • Chain 'D':
    Compound: steroid receptor coactivator-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1U3S (Start-12)
  • Heterogens: 797, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u3sA (A:)
    dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3sA (A:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmyadssrklahllnavtdalvwviaksgissqq
    qsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u3sB (B:)
    dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3sB (B:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssssrklahllnavtdalvwviaksgissqqqsmr
    lanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.