PDB entry 1u3p

View 1u3p on RCSB PDB site
Description: IspF native
Class: lyase
Keywords: lyase, MEP pathway, terpene biosynthesis
Deposited on 2004-07-22, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.226
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: ispF, mecS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u3pa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u3pA (A:)
    mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
    fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
    gchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3pA (A:)
    mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
    fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
    gchmddvnvkattteklgftgrgegiaceavalli