PDB entry 1u3o

View 1u3o on RCSB PDB site
Description: Solution structure of rat Kalirin N-terminal SH3 domain
Class: signaling protein
Keywords: SH3, cis-Proline,, signaling protein
Deposited on 2004-07-22, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Huntingtin-associated protein-interacting protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kalirin, HAPIP, Duo
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u3oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u3oA (A:)
    gplgspgipgstlsggceltvvlqdfsaahsselsiqvgqtvellerpserpgwclvrtt
    ersppqeglvpsstlcishsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3oA (A:)
    sggceltvvlqdfsaahsselsiqvgqtvellerpserpgwclvrttersppqeglvpss
    tlcishs