PDB entry 1u3n

View 1u3n on RCSB PDB site
Description: A SOD-like protein from B. subtilis, unstructured in solution, becomes ordered in the crystal: implications for function and for fibrillogenesis
Class: unknown function
Keywords: SOD-like; Bacillus subtilis; BsSOD; solution structure; NMR; Metalloprotein, UNKNOWN FUNCTION
Deposited on 2004-07-22, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical superoxide dismutase-like protein yojM
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YOJM, BSU19400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u3na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3nA (A:)
    vvetsafghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscv
    rpdfesaggpfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgskln
    ildedgsafiiheqaddyltnpsgnsgarivcgallgnnekq