PDB entry 1u3m

View 1u3m on RCSB PDB site
Description: nmr structure of the chicken prion protein fragment 128-242
Deposited on 2004-07-22, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u3ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3mA (A:)
    gsvvgglggyamgrvmsgmnyhfdrpdeyrwwsensarypnrvyyrdysspvpqdvfvad
    cfnitvteysigpaakkntseavaaanqtevemenkvvtkviremcvqqyreyrlas